Lineage for d1i9bc1 (1i9b C:2-205)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2084602Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2084603Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 2084604Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries)
  8. 2084673Domain d1i9bc1: 1i9b C:2-205 [62086]
    Other proteins in same PDB: d1i9ba2, d1i9bb2, d1i9bc2, d1i9bd2, d1i9be2
    complexed with ca, epe

Details for d1i9bc1

PDB Entry: 1i9b (more details), 2.7 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp)
PDB Compounds: (C:) acetylcholine binding protein

SCOPe Domain Sequences for d1i9bc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9bc1 b.96.1.1 (C:2-205) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d1i9bc1:

Click to download the PDB-style file with coordinates for d1i9bc1.
(The format of our PDB-style files is described here.)

Timeline for d1i9bc1: