Lineage for d1i99i_ (1i99 I:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86314Fold e.1: Serpins [56573] (1 superfamily)
  4. 86315Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 86316Family e.1.1.1: Serpins [56575] (11 proteins)
  6. 86317Protein Alaserpin (serpin 1) [64469] (1 species)
  7. 86318Species Tobacco hornworm (Manduca sexta) [TaxId:7130] [64470] (1 PDB entry)
  8. 86319Domain d1i99i_: 1i99 I: [62081]
    Other proteins in same PDB: d1i99e_

Details for d1i99i_

PDB Entry: 1i99 (more details), 2.3 Å

PDB Description: crystal structure of michaelis serpin-trypsin complex

SCOP Domain Sequences for d1i99i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i99i_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta)}
getdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshdell
ralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgsev
qnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkfvk
ertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnqvd
gitaleqklkdpkalsraeerlynteveitlpkfkietttdlkevlsnmnikklftpgaa
rlenllktkesltvdaaiqkafievneegaeaaaanafgivpkslilypevhidrpfyfe
lkidgipmfngkviep

SCOP Domain Coordinates for d1i99i_:

Click to download the PDB-style file with coordinates for d1i99i_.
(The format of our PDB-style files is described here.)

Timeline for d1i99i_:

  • d1i99i_ is new in SCOP 1.57
  • d1i99i_ became obsolete in SCOP 1.59

View in 3D
Domains from other chains:
(mouse over for more information)
d1i99e_