Lineage for d1i99e_ (1i99 E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60859Protein Trypsin(ogen) [50515] (6 species)
  7. 61033Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (25 PDB entries)
  8. 61056Domain d1i99e_: 1i99 E: [62080]
    Other proteins in same PDB: d1i99i_

Details for d1i99e_

PDB Entry: 1i99 (more details), 2.3 Å

PDB Description: crystal structure of michaelis serpin-trypsin complex

SCOP Domain Sequences for d1i99e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i99e_ b.47.1.2 (E:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOP Domain Coordinates for d1i99e_:

Click to download the PDB-style file with coordinates for d1i99e_.
(The format of our PDB-style files is described here.)

Timeline for d1i99e_:

  • d1i99e_ is new in SCOP 1.57
  • d1i99e_ became obsolete in SCOP 1.59

View in 3D
Domains from other chains:
(mouse over for more information)
d1i99i_