Class a: All alpha proteins [46456] (179 folds) |
Fold a.7: Spectrin repeat-like [46965] (8 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) |
Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
Protein Ribosomal protein S20 [46994] (1 species) |
Species Thermus thermophilus [TaxId:274] [46995] (14 PDB entries) |
Domain d1i97t_: 1i97 T: [62078] Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97u_ complexed with mg, tac, wo2, zn |
PDB Entry: 1i97 (more details), 4.5 Å
SCOP Domain Sequences for d1i97t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i97t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus} rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d1i97t_: