Lineage for d1i97t_ (1i97 T:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 95722Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
  4. 95791Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 95792Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 95793Protein Ribosomal protein S20 [46994] (1 species)
  7. 95794Species Thermus thermophilus [TaxId:274] [46995] (10 PDB entries)
  8. 95803Domain d1i97t_: 1i97 T: [62078]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97u_

Details for d1i97t_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1i97t_:

Click to download the PDB-style file with coordinates for d1i97t_.
(The format of our PDB-style files is described here.)

Timeline for d1i97t_: