SCOPe 2.03: Domain d1i97r_: 1i97 R:

Lineage for d1i97r_ (1i97 R:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
   Uniprot P80382

8. Domain d1i97r_: 1i97 R: [62076]
   Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97s_, d1i97t_, d1i97u_
   complexed with mg, tac, wo2, zn

Details for d1i97r_

PDB Entry: 1i97, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1i97r_:

Sequence; same for both SEQRES and ATOM records:

>d1i97r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqril
aktikrarilgllpfteklvrk

Timeline for d1i97r_:

• d1i97r_ first appeared in SCOP 1.57
  
• d1i97r_ appears in SCOPe 2.02
  
• d1i97r_ appears in SCOPe 2.04
  
• d1i97r_ appears in the current release, SCOPe 2.08