![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) ![]() |
![]() | Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit |
![]() | Protein Ribosomal protein S15 [47065] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47067] (19 PDB entries) |
![]() | Domain d1i97o_: 1i97 O: [62073] Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_ complexed with mg, tac, wo2, zn |
PDB Entry: 1i97 (more details), 4.5 Å
SCOP Domain Sequences for d1i97o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i97o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d1i97o_: