Lineage for d1i97o_ (1i97 O:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46191Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
  4. 46192Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 46199Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
  6. 46200Protein Ribosomal protein S15 [47065] (2 species)
  7. 46203Species Thermus thermophilus [TaxId:274] [47067] (14 PDB entries)
  8. 46215Domain d1i97o_: 1i97 O: [62073]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_

Details for d1i97o_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1i97o_:

Click to download the PDB-style file with coordinates for d1i97o_.
(The format of our PDB-style files is described here.)

Timeline for d1i97o_: