SCOP 1.65: Domain d1i97n_: 1i97 N:

Lineage for d1i97n_ (1i97 N:)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (14 PDB entries)

8. Domain d1i97n_: 1i97 N: [62072]
   Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
   complexed with mg, tac, wo2, zn

Details for d1i97n_

PDB Entry: 1i97, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97n_:

Sequence; same for both SEQRES and ATOM records:

>d1i97n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1i97n_:

• d1i97n_ first appeared in SCOP 1.57
  
• d1i97n_ appears in SCOP 1.63
  
• d1i97n_ appears in SCOP 1.67
  
• d1i97n_ appears in the current release, SCOPe 2.08