Lineage for d1i97l_ (1i97 L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399564Protein Ribosomal protein S12 [50302] (2 species)
  7. 2399591Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries)
    Uniprot P17293
  8. 2399618Domain d1i97l_: 1i97 L: [62070]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
    complexed with mg, tac, wo2, zn

Details for d1i97l_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d1i97l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkeaaktaakk

SCOPe Domain Coordinates for d1i97l_:

Click to download the PDB-style file with coordinates for d1i97l_.
(The format of our PDB-style files is described here.)

Timeline for d1i97l_: