Lineage for d1i97k_ (1i97 K:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 317197Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 317198Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 317215Protein Ribosomal protein S11 [53141] (1 species)
  7. 317216Species Thermus thermophilus [TaxId:274] [53142] (14 PDB entries)
  8. 317228Domain d1i97k_: 1i97 K: [62069]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
    complexed with mg, tac, wo2, zn

Details for d1i97k_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
kkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaal
daakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr
kas

SCOP Domain Coordinates for d1i97k_:

Click to download the PDB-style file with coordinates for d1i97k_.
(The format of our PDB-style files is described here.)

Timeline for d1i97k_: