Lineage for d1i97f_ (1i97 F:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) 
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) 
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) Protein Ribosomal protein S6 [54997] (1 species) Species Thermus thermophilus [TaxId:274] [54998] (16 PDB entries) 
Domain d1i97f_: 1i97 F: [62064]
Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
Details for d1i97f_
PDB Entry: 1i97 (more details), 4.5 Å
PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline
SCOP Domain Sequences for d1i97f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i97f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
SCOP Domain Coordinates for d1i97f_:
Click to download the PDB-style file with coordinates for d1i97f_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i97f_:
- d1i97f_ first appeared in SCOP 1.57
- d1i97f_ appears in SCOP 1.61
- d1i97f_ appears in the current release, SCOPe 2.08
View in 3D
