Lineage for d1i97c2 (1i97 C:107-207)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412647Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 1412648Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 1412649Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 1412650Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 1412676Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 1412703Domain d1i97c2: 1i97 C:107-207 [62060]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
    complexed with mg, tac, wo2, zn

Details for d1i97c2

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1i97c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1i97c2:

Click to download the PDB-style file with coordinates for d1i97c2.
(The format of our PDB-style files is described here.)

Timeline for d1i97c2: