Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) automatically mapped to Pfam PF00189 |
Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries) Uniprot P80372 |
Domain d1i97c2: 1i97 C:107-207 [62060] Other proteins in same PDB: d1i97b_, d1i97c1, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_ complexed with mg, tac, wo2, zn |
PDB Entry: 1i97 (more details), 4.5 Å
SCOPe Domain Sequences for d1i97c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i97c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]} qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d1i97c2: