| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.68: IF3-like [55199] (7 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.1: Translation initiation factor IF3, C-terminal domain [55200] (1 family) ![]() |
| Family d.68.1.1: Translation initiation factor IF3, C-terminal domain [55201] (1 protein) |
| Protein Translation initiation factor IF3, C-terminal domain [55202] (3 species) |
| Species Thermus thermophilus [TaxId:274] [64306] (1 PDB entry) |
| Domain d1i96v_: 1i96 V: [62057] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_ complexed to 30S ribosomal subunit; CA-atoms only complexed with mg, wo2, zn |
PDB Entry: 1i96 (more details), 4.2 Å
SCOP Domain Sequences for d1i96v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96v_ d.68.1.1 (V:) Translation initiation factor IF3, C-terminal domain {Thermus thermophilus [TaxId: 274]}
evksikfrvkidehdyqtklghikrflqeghkvkvtimfrgrevahpelgerilnrvted
lkdlavvemkpemlgrdmnmllapvk
Timeline for d1i96v_: