Lineage for d1i96r_ (1i96 R:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636073Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 636074Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 636075Protein Ribosomal protein S18 [46913] (1 species)
  7. 636076Species Thermus thermophilus [TaxId:274] [46914] (38 PDB entries)
  8. 636100Domain d1i96r_: 1i96 R: [62053]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
    complexed with mg, wo2, zn

Details for d1i96r_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)
PDB Compounds: (R:) 30S ribosomal protein S18

SCOP Domain Sequences for d1i96r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqril
aktikrarilgllpfteklvrk

SCOP Domain Coordinates for d1i96r_:

Click to download the PDB-style file with coordinates for d1i96r_.
(The format of our PDB-style files is described here.)

Timeline for d1i96r_: