![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
![]() | Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
![]() | Protein Ribosomal protein S18 [46913] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries) |
![]() | Domain d1i96r_: 1i96 R: [62053] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ complexed with mg, wo2, zn |
PDB Entry: 1i96 (more details), 4.2 Å
SCOP Domain Sequences for d1i96r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus} kpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqril aktikrarilgllpfteklvrk
Timeline for d1i96r_: