Lineage for d1i96n_ (1i96 N:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750502Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 750503Protein Ribosomal protein S14 [57753] (1 species)
  7. 750504Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)
  8. 750528Domain d1i96n_: 1i96 N: [62049]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
    complexed with mg, wo2, zn

Details for d1i96n_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)
PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d1i96n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1i96n_:

Click to download the PDB-style file with coordinates for d1i96n_.
(The format of our PDB-style files is described here.)

Timeline for d1i96n_: