Class a: All alpha proteins [46456] (171 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) |
Protein Ribosomal protein S13 [46948] (1 species) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
Species Thermus thermophilus [TaxId:274] [46949] (14 PDB entries) |
Domain d1i96m_: 1i96 M: [62048] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ complexed with mg, wo2, zn |
PDB Entry: 1i96 (more details), 4.2 Å
SCOP Domain Sequences for d1i96m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96m_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrr
Timeline for d1i96m_: