Lineage for d1i96f_ (1i96 F:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725083Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 725084Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 725085Protein Ribosomal protein S6 [54997] (2 species)
  7. 725088Species Thermus thermophilus [TaxId:274] [54998] (42 PDB entries)
  8. 725114Domain d1i96f_: 1i96 F: [62041]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
    complexed with mg, wo2, zn

Details for d1i96f_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)
PDB Compounds: (F:) 30S ribosomal protein S6

SCOP Domain Sequences for d1i96f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1i96f_:

Click to download the PDB-style file with coordinates for d1i96f_.
(The format of our PDB-style files is described here.)

Timeline for d1i96f_: