SCOPe 2.06: Domain d1i96c2: 1i96 C:107-207

Lineage for d1i96c2 (1i96 C:107-207)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
   Uniprot P80372

8. Domain d1i96c2: 1i96 C:107-207 [62037]
   Other proteins in same PDB: d1i96b_, d1i96c1, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
   complexed with mg, wo2, zn

Details for d1i96c2

PDB Entry: 1i96, 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1i96c2:

Sequence; same for both SEQRES and ATOM records:

>d1i96c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d1i96c2:

• d1i96c2 first appeared in SCOP 1.57
  
• d1i96c2 appears in SCOPe 2.05
  
• d1i96c2 appears in SCOPe 2.07
  
• d1i96c2 appears in the current release, SCOPe 2.08