| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
| Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
| Protein Ribosomal protein S3 N-terminal domain [54816] (4 species) |
| Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries) Uniprot P80372 |
| Domain d1i96c1: 1i96 C:2-106 [62036] Other proteins in same PDB: d1i96b_, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ complexed with mg, wo2, zn |
PDB Entry: 1i96 (more details), 4.2 Å
SCOPe Domain Sequences for d1i96c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1i96c1: