Lineage for d1i96b_ (1i96 B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692769Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 692770Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 692771Protein Ribosomal protein S2 [52315] (2 species)
  7. 692781Species Thermus thermophilus [TaxId:274] [52316] (36 PDB entries)
  8. 692804Domain d1i96b_: 1i96 B: [62035]
    Other proteins in same PDB: d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
    complexed with mg, wo2, zn

Details for d1i96b_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)
PDB Compounds: (B:) 30S ribosomal protein S2

SCOP Domain Sequences for d1i96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl
amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal
faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf
ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe
aeatetpeg

SCOP Domain Coordinates for d1i96b_:

Click to download the PDB-style file with coordinates for d1i96b_.
(The format of our PDB-style files is described here.)

Timeline for d1i96b_: