Lineage for d1i95t_ (1i95 T:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211240Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 211323Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 211324Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 211325Protein Ribosomal protein S20 [46994] (1 species)
  7. 211326Species Thermus thermophilus [TaxId:274] [46995] (14 PDB entries)
  8. 211339Domain d1i95t_: 1i95 T: [62033]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95u_
    complexed with ede, mg, wo2, zn

Details for d1i95t_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1i95t_:

Click to download the PDB-style file with coordinates for d1i95t_.
(The format of our PDB-style files is described here.)

Timeline for d1i95t_: