![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
![]() | Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() automatically mapped to Pfam PF00203 |
![]() | Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
![]() | Protein Ribosomal protein S19 [54572] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) Uniprot P80381 |
![]() | Domain d1i95s_: 1i95 S: [62032] Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95t_, d1i95u_ complexed with ede, mg, wo2, zn |
PDB Entry: 1i95 (more details), 4.5 Å
SCOPe Domain Sequences for d1i95s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i95s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d1i95s_: