Lineage for d1i95s_ (1i95 S:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132369Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
  4. 132370Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 132371Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 132372Protein Ribosomal protein S19 [54572] (1 species)
  7. 132373Species Thermus thermophilus [TaxId:274] [54573] (12 PDB entries)
  8. 132384Domain d1i95s_: 1i95 S: [62032]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95t_, d1i95u_

Details for d1i95s_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1i95s_:

Click to download the PDB-style file with coordinates for d1i95s_.
(The format of our PDB-style files is described here.)

Timeline for d1i95s_: