SCOP 1.61: Domain d1i95q_: 1i95 Q:

Lineage for d1i95q_ (1i95 Q:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (15 proteins)

6. Protein Ribosomal protein S17 [50304] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50305] (10 PDB entries)

8. Domain d1i95q_: 1i95 Q: [62030]
   Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95r_, d1i95s_, d1i95t_, d1i95u_

Details for d1i95q_

PDB Entry: 1i95, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95q_:

Sequence; same for both SEQRES and ATOM records:

>d1i95q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeerykvgdvveiie
arpiskrkrfrvlrlveegrldlvekylvrrqnyaslskrggka

Timeline for d1i95q_:

• d1i95q_ first appeared in SCOP 1.57
  
• d1i95q_ appears in SCOP 1.59
  
• d1i95q_ appears in SCOP 1.63
  
• d1i95q_ appears in the current release, SCOPe 2.08