Lineage for d1i95p_ (1i95 P:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410273Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 410274Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 410275Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 410276Protein Ribosomal protein S16 [54567] (1 species)
  7. 410277Species Thermus thermophilus [TaxId:274] [54568] (15 PDB entries)
  8. 410292Domain d1i95p_: 1i95 P: [62029]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
    complexed with ede, mg, wo2, zn

Details for d1i95p_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95p_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqearega

SCOP Domain Coordinates for d1i95p_:

Click to download the PDB-style file with coordinates for d1i95p_.
(The format of our PDB-style files is described here.)

Timeline for d1i95p_: