SCOPe 2.04: Domain d1i95o_: 1i95 O:

Lineage for d1i95o_ (1i95 O:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array
4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit
   automatically mapped to Pfam PF00312

6. Protein Ribosomal protein S15 [47065] (3 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
   Uniprot P80378

8. Domain d1i95o_: 1i95 O: [62028]
   Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
   complexed with ede, mg, wo2, zn

Details for d1i95o_

PDB Entry: 1i95, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1i95o_:

Sequence; same for both SEQRES and ATOM records:

>d1i95o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

Timeline for d1i95o_:

• d1i95o_ first appeared in SCOP 1.57
  
• d1i95o_ appears in SCOPe 2.03
  
• d1i95o_ appears in SCOPe 2.05
  
• d1i95o_ appears in the current release, SCOPe 2.08