Lineage for d1i95o_ (1i95 O:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440036Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 440037Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 440044Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 440045Protein Ribosomal protein S15 [47065] (2 species)
  7. 440048Species Thermus thermophilus [TaxId:274] [47067] (19 PDB entries)
  8. 440066Domain d1i95o_: 1i95 O: [62028]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_

Details for d1i95o_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1i95o_:

Click to download the PDB-style file with coordinates for d1i95o_.
(The format of our PDB-style files is described here.)

Timeline for d1i95o_: