Lineage for d1i95m_ (1i95 M:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779264Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 779265Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 779266Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
  6. 779267Protein Ribosomal protein S13 [46948] (2 species)
  7. 779295Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries)
    Uniprot P80377
  8. 779327Domain d1i95m_: 1i95 M: [62026]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
    complexed with ede, mg, wo2, zn

Details for d1i95m_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine
PDB Compounds: (M:) 30S ribosomal protein S13

SCOP Domain Sequences for d1i95m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95m_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrr

SCOP Domain Coordinates for d1i95m_:

Click to download the PDB-style file with coordinates for d1i95m_.
(The format of our PDB-style files is described here.)

Timeline for d1i95m_: