Lineage for d1i95m_ (1i95 M:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45908Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 45955Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family) (S)
  5. 45956Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein)
  6. 45957Protein Ribosomal protein S13 [46948] (1 species)
  7. 45958Species Thermus thermophilus [TaxId:274] [46949] (10 PDB entries)
  8. 45968Domain d1i95m_: 1i95 M: [62026]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_

Details for d1i95m_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95m_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrr

SCOP Domain Coordinates for d1i95m_:

Click to download the PDB-style file with coordinates for d1i95m_.
(The format of our PDB-style files is described here.)

Timeline for d1i95m_: