Lineage for d1i95l_ (1i95 L:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059775Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 2060038Protein Ribosomal protein S12 [50302] (2 species)
  7. 2060065Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries)
    Uniprot P17293
  8. 2060093Domain d1i95l_: 1i95 L: [62025]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
    complexed with ede, mg, wo2, zn

Details for d1i95l_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d1i95l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkeaaktaakk

SCOPe Domain Coordinates for d1i95l_:

Click to download the PDB-style file with coordinates for d1i95l_.
(The format of our PDB-style files is described here.)

Timeline for d1i95l_: