Lineage for d1i95i_ (1i95 I:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537230Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2537343Protein Ribosomal protein S9 [54218] (2 species)
  7. 2537371Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
    Uniprot P80374
  8. 2537403Domain d1i95i_: 1i95 I: [62022]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
    complexed with ede, mg, wo2, zn

Details for d1i95i_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d1i95i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95i_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOPe Domain Coordinates for d1i95i_:

Click to download the PDB-style file with coordinates for d1i95i_.
(The format of our PDB-style files is described here.)

Timeline for d1i95i_: