![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
![]() | Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) ![]() |
![]() | Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
![]() | Protein Ribosomal protein S7 [47975] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47977] (15 PDB entries) |
![]() | Domain d1i95g_: 1i95 G: [62020] Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_ complexed with ede, mg, wo2, zn |
PDB Entry: 1i95 (more details), 4.5 Å
SCOP Domain Sequences for d1i95g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i95g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus} arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria helmdaaegkggavkkkedvermaeanrayahyrw
Timeline for d1i95g_: