Lineage for d1i95d_ (1i95 D:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134419Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
  4. 134420Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) (S)
  5. 134425Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
  6. 134426Protein Ribosomal protein S4 [55179] (2 species)
  7. 134430Species Thermus thermophilus [TaxId:274] [55180] (10 PDB entries)
  8. 134440Domain d1i95d_: 1i95 D: [62016]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_

Details for d1i95d_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95d_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOP Domain Coordinates for d1i95d_:

Click to download the PDB-style file with coordinates for d1i95d_.
(The format of our PDB-style files is described here.)

Timeline for d1i95d_: