Lineage for d1i95c1 (1i95 C:2-106)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256779Fold d.52: Alpha-lytic protease prodomain-like [54805] (6 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 256806Superfamily d.52.3: Prokaryotic type KH domain (pKH-domain) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 256807Family d.52.3.1: Prokaryotic type KH domain (pKH-domain) [54815] (4 proteins)
  6. 256816Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)
  7. 256817Species Thermus thermophilus [TaxId:274] [54817] (14 PDB entries)
  8. 256830Domain d1i95c1: 1i95 C:2-106 [62014]
    Other proteins in same PDB: d1i95b_, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
    complexed with ede, mg, wo2, zn

Details for d1i95c1

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1i95c1:

Click to download the PDB-style file with coordinates for d1i95c1.
(The format of our PDB-style files is described here.)

Timeline for d1i95c1: