![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
![]() | Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
![]() | Protein Ribosomal protein S2 [52315] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52316] (14 PDB entries) |
![]() | Domain d1i95b_: 1i95 B: [62013] Other proteins in same PDB: d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_ complexed with ede, mg, wo2, zn |
PDB Entry: 1i95 (more details), 4.5 Å
SCOP Domain Sequences for d1i95b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i95b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus} pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe aeatetpeg
Timeline for d1i95b_: