Lineage for d1i94t_ (1i94 T:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278620Fold a.7: Spectrin repeat-like [46965] (8 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 278706Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 278707Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 278708Protein Ribosomal protein S20 [46994] (1 species)
  7. 278709Species Thermus thermophilus [TaxId:274] [46995] (14 PDB entries)
  8. 278716Domain d1i94t_: 1i94 T: [62011]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94t_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1i94t_:

Click to download the PDB-style file with coordinates for d1i94t_.
(The format of our PDB-style files is described here.)

Timeline for d1i94t_: