| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() |
| Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
| Protein Ribosomal protein S19 [54572] (1 species) |
| Species Thermus thermophilus [TaxId:274] [54573] (16 PDB entries) |
| Domain d1i94s_: 1i94 S: [62010] Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94t_, d1i94u_ complexed with mg, wo2, zn |
PDB Entry: 1i94 (more details), 3.2 Å
SCOP Domain Sequences for d1i94s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i94s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr
Timeline for d1i94s_: