Lineage for d1i94r_ (1i94 R:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 278372Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 278373Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 278374Protein Ribosomal protein S18 [46913] (1 species)
  7. 278375Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries)
  8. 278382Domain d1i94r_: 1i94 R: [62009]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94r_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
kpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqril
aktikrarilgllpfteklvrk

SCOP Domain Coordinates for d1i94r_:

Click to download the PDB-style file with coordinates for d1i94r_.
(The format of our PDB-style files is described here.)

Timeline for d1i94r_: