Lineage for d1i94q_ (1i94 Q:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1125285Protein Ribosomal protein S17 [50304] (3 species)
  7. 1125315Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 1125334Domain d1i94q_: 1i94 Q: [62008]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94q_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d1i94q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeerykvgdvveiie
arpiskrkrfrvlrlveegrldlvekylvrrqnyaslskrggka

SCOPe Domain Coordinates for d1i94q_:

Click to download the PDB-style file with coordinates for d1i94q_.
(The format of our PDB-style files is described here.)

Timeline for d1i94q_: