Class a: All alpha proteins [46456] (258 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) |
Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit |
Protein Ribosomal protein S15 [47065] (2 species) |
Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) |
Domain d1i94o_: 1i94 O: [62006] Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_ complexed with mg, wo2, zn |
PDB Entry: 1i94 (more details), 3.2 Å
SCOP Domain Sequences for d1i94o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i94o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d1i94o_: