Lineage for d1i94o_ (1i94 O:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46191Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
  4. 46192Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 46199Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
  6. 46200Protein Ribosomal protein S15 [47065] (2 species)
  7. 46203Species Thermus thermophilus [TaxId:274] [47067] (14 PDB entries)
  8. 46208Domain d1i94o_: 1i94 O: [62006]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_

Details for d1i94o_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1i94o_:

Click to download the PDB-style file with coordinates for d1i94o_.
(The format of our PDB-style files is described here.)

Timeline for d1i94o_: