Lineage for d1i94n_ (1i94 N:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244274Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1244275Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1244607Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1244608Protein Ribosomal protein S14 [57753] (2 species)
  7. 1244634Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1244653Domain d1i94n_: 1i94 N: [62005]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94n_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d1i94n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d1i94n_:

Click to download the PDB-style file with coordinates for d1i94n_.
(The format of our PDB-style files is described here.)

Timeline for d1i94n_: