SCOP 1.73: Domain d1i94n_: 1i94 N:

Lineage for d1i94n_ (1i94 N:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)

8. Domain d1i94n_: 1i94 N: [62005]
   Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
   complexed with mg, wo2, zn

Details for d1i94n_

PDB Entry: 1i94, 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d1i94n_:

Sequence; same for both SEQRES and ATOM records:

>d1i94n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1i94n_:

• d1i94n_ first appeared in SCOP 1.57
  
• d1i94n_ appears in SCOP 1.71
  
• d1i94n_ appears in SCOP 1.75
  
• d1i94n_ appears in the current release, SCOPe 2.08