SCOP 1.63: Domain d1i94l_: 1i94 L:

Lineage for d1i94l_ (1i94 L:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S12 [50302] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50303] (14 PDB entries)

8. Domain d1i94l_: 1i94 L: [62003]
   Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
   complexed with mg, wo2, zn

Details for d1i94l_

PDB Entry: 1i94, 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94l_:

Sequence; same for both SEQRES and ATOM records:

>d1i94l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkeaaktaakk

Timeline for d1i94l_:

• d1i94l_ first appeared in SCOP 1.57
  
• d1i94l_ appears in SCOP 1.61
  
• d1i94l_ appears in SCOP 1.65
  
• d1i94l_ appears in the current release, SCOPe 2.08