SCOP 1.59: Domain d1i94j_: 1i94 J:

Lineage for d1i94j_ (1i94 J:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family)

5. Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)

6. Protein Ribosomal protein S10 [55001] (1 species)

7. Species Thermus thermophilus [TaxId:274] [55002] (10 PDB entries)

8. Domain d1i94j_: 1i94 J: [62001]
   Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_

Details for d1i94j_

PDB Entry: 1i94, 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94j_:

Sequence; same for both SEQRES and ATOM records:

>d1i94j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

Timeline for d1i94j_:

• d1i94j_ first appeared in SCOP 1.57
  
• d1i94j_ appears in SCOP 1.61
  
• d1i94j_ appears in the current release, SCOPe 2.08