Lineage for d1i94i_ (1i94 I:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325230Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 325231Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (7 families) (S)
  5. 325232Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 325263Protein Ribosomal protein S9 [54218] (1 species)
  7. 325264Species Thermus thermophilus [TaxId:274] [54219] (14 PDB entries)
  8. 325271Domain d1i94i_: 1i94 I: [62000]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94i_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94i_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d1i94i_:

Click to download the PDB-style file with coordinates for d1i94i_.
(The format of our PDB-style files is described here.)

Timeline for d1i94i_: