SCOPe 2.06: Domain d1i94h_: 1i94 H:

Lineage for d1i94h_ (1i94 H:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
   consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)
   automatically mapped to Pfam PF00410

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (4 species)

7. Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
   Uniprot P24319

8. Domain d1i94h_: 1i94 H: [61999]
   Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
   complexed with mg, wo2, zn

Details for d1i94h_

PDB Entry: 1i94, 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1i94h_:

Sequence; same for both SEQRES and ATOM records:

>d1i94h_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestevpasrfkeeilkilaregfikgyervevdgkpylr
ihlkygprrqgpdprpeqvikhirrisrpgrrvyvgvkeiprvrrglgiailstpkgvlt
drearklgvggelicevw

Timeline for d1i94h_:

• d1i94h_ first appeared in SCOP 1.57
  
• d1i94h_ appears in SCOPe 2.05
  
• d1i94h_ appears in SCOPe 2.07
  
• d1i94h_ appears in the current release, SCOPe 2.08