SCOP 1.57: Domain d1i94g_: 1i94 G:

Lineage for d1i94g_ (1i94 G:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)

4. Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family)

5. Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)

6. Protein Ribosomal protein S7 [47975] (3 species)

7. Species Thermus thermophilus [TaxId:274] [47977] (11 PDB entries)

8. Domain d1i94g_: 1i94 G: [61998]
   Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_

Details for d1i94g_

PDB Entry: 1i94, 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94g_:

Sequence; same for both SEQRES and ATOM records:

>d1i94g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

Timeline for d1i94g_:

• d1i94g_ is new in SCOP 1.57
  
• d1i94g_ appears in SCOP 1.59
  
• d1i94g_ appears in the current release, SCOPe 2.08